A polypeptide comprising a portion of the sequence of the general formula
(I): CNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSG, of 6-23 amino acids in length and
comprising sequence a) and/or b): a) GGRKVF, b) FELVGEPSIY multimeric and
chimeric derivatives, pharmaceutiocal compositions containing them and
their use in therapy.
Un polipéptido que abarca una porción de la secuencia del fórmula general (i): CNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSG, de 6-23 aminoácidos en la longitud y la secuencia el abarcar a) y/o b): a) GGRKVF, b) derivados multimeric y quiméricos de FELVGEPSIY, composiciones pharmaceutiocal que contienen los y su uso en terapia.
