A mammalian milk growth factor (MMGF) having the following amino acid sequence or substantially homologous sequence: DGNSTRSPEDDGLLCGDHAENCPATTTQPKRRGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYAGARCE RVDLFY (SEQ ID NO:2) or a mutant, analogue, derivative or functionally active fragment thereof.

Een zoogdierfactor die van de melkgroei (MMGF) de volgende aminozuuropeenvolging of wezenlijk homologe opeenvolging heeft: DGNSTRSPEDDGLLCGDHAENCPATTTQPKRRGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYAGARCE RVDLFY (SEQ identiteitskaart NO:2) of een mutant, analogon, een afgeleid of functioneel actief fragment daarvan.

 
Web www.patentalert.com

< Methods and kits for detecting protein kinases

< Pyrazole compositions useful as inhibitors of ERK

> Modified milk growth factor

> Tricyclic protein kinase inhibitors

~ 00063